Leta i den här bloggen

fredag 6 april 2018

TRIM50( Kr.7q11.23), TRIM50A,(C_IV, PRY/SPRY) Proteosomitie tai vaihtoehtoisesti autofagosomitie

TRIM50, (Kr.7q11.23), TRIM50A, FLJ33804, (C_IV,PRY/SPRY)

https://www.ncbi.nlm.nih.gov/gene/135892
https://www.ncbi.nlm.nih.gov/protein/NP_001268379.1
Tavallinen tripartiittinen TRIM rakenne RING, Bbox 1, ja 2, Coiled-coil domeeni. Alaryhmä C_IV eli C-terminaalissa on PRY/SPRY. Aminohappoja 468. Ilmenemää on eniten mahalaukussa, testiksessä ja 8 muussa kudoksessa.
TRIM50A, Expression
Biased expression in stomach (RPKM 3.4), testis (RPKM 2.8) and 8 other tissues See more

Artikkeleita.Related articles in PubMed:

TRIM ja HDAC6 , TRIM ja KAT3B(p300) ja KAT2B(PCAF)

  • Fusco C, et al. Cell Signal, 2014 Feb. PMID 24308962
  • (Suom). E3 ubikitiiniligaasi TRIM50 edistää polyubikitinoitujen proteiinien aggresomin muodostamista ja selvittelyä (hajoittamista) ja tässä sitä avustaa HDAC6-interaktio. HDAC6 on tubuliinispesifinen deasetylaasi ( Ac-ryhmän poistaja), joka säätelee mikrotubuluksista riippuvaista aggresomin muodostusta. Tässä artikkelissa osoitetaan, että TRIM50 on HDAC6-entsyymin suoranainen kohde.
  • TRIM50 Lys-375 on asetylaatiossa kriittinen.
  • P300 ja PCAF ovat TRIM50 asetyylitransferaaseja.
  • Tasapaino ubikitinaation ja asetylaation kesken säätelee TRIM50 degradaatiota.
  • The E3 Ubiquitin ligase TRIM50 promotes the formation and clearance of aggresome-associated polyubiquitinated proteins through HDAC6 interaction, a tubulin specific deacetylase that regulates microtubule-dependent aggresome formation. In this report we showed that TRIM50 is a target of HDAC6 with Lys-372 as a critical residue for acetylation. We identified p300 and PCAF as two TRIM50 acetyltransferases and we further showed that a balance between ubiquitination and acetylation regulates TRIM50 degradation.
  • Viite1: PCAF on KAT2B, lysiini (K)asetyylitransferaas1 2B, CAF, P/CAF.https://www.ncbi.nlm.nih.gov/gene/8850
  • Viite2: p300 on KAT3B, RSTS, EP300, myös histoniasetyltransferaasi
    https://www.ncbi.nlm.nih.gov/pubmed/28953875

TRIM50 ja WBS geeniklusteri kr.7q11.23

  • Williams-Beuren syndrome TRIM50 encodes an E3 ubiquitin ligase. Micale L, et al. Eur J Hum Genet, 2008 Sep. PMID 18398435, Free PMC Article
  • (Suomennosta) WBS-oireyhtymä on neurokehityksellinen ja monisysteemitauti, joka johtuu kromosomi7q11.23-alueelle asettuvan n. 25 geenin hemizygoottisuudesta. Tässä artikkelissa mainitaan 8 uutta geeniä siltä alueelta, joka on WBS-oireyhtymsööä kriittinen. Kolme näistä geeneistä on TRIMgeenejä: TIM50, TRIM73 ja TRIM74. Ne osallistuvat useihin geneettisiin tauteihin. Ubikitiinivälitteinen proteosomitie saattaa olla osallistunut WBS-fenotyyppiin.
  • Williams-Beuren syndrome (WBS) is a neurodevelopmental and multisystemic disease that results from hemizygosity of approximately 25 genes mapping to chromosomal region 7q11.23. We report here the preliminary description of eight novel genes mapping within the WBS critical region and/or its syntenic mouse region. Three of these genes, TRIM50, TRIM73 and TRIM74, belong to the TRIpartite motif gene family, members of which were shown to be associated to several human genetic diseases. We describe the preliminary functional characterization of these genes and show that Trim50 encodes an E3 ubiquitin ligase, opening the interesting hypothesis that the ubiquitin-mediated proteasome pathway might be involved in the WBS phenotype.

TRIM50 ja aggresomin autofagosomitie, HDAC6, p62

  • (Suomennosta) Vasteena proteosomi-inhibitiolle TRIM50 lokalisoituu ja edistää polyubikitinoitujen proteiinien rekrytoimista ja aggrekoimista aggresomiin. Tätä lokalisaatiota välittää HDAC6. TRIM50 lokalisoituu samaan kuin p62, tekee sen kanssa interaktion ja nostaa sen pitoisuuksia. P62 on multifunktionaalinen adaptoriproteiini, joka osallistuu moneen soluprosessiin kuten myös polyubikitinoitujen proteiiniaggrekaattien autofagosomaaliseen hajoittamiseen.
  • In this study we report that, in response to proteasome inhibition, the E3-Ubiquitin ligase TRIM50 localizes to and promotes the recruitment and aggregation of polyubiquitinated proteins to the aggresome. Using Hdac6-deficient mouse embryo fibroblasts (MEF) we show that this localization is mediated by the histone deacetylase 6, HDAC6.
  • TRIM50-deficient MEFs allow pinpointing that the TRIM50 ubiquitin-ligase regulates the clearance of polyubiquitinated proteins localized to the aggresome. Finally we demonstrate that TRIM50 colocalizes, interacts with and increases the level of p62, a multifunctional adaptor protein implicated in various cellular processes including the autophagy clearance of polyubiquitinated protein aggregates. We speculate that when the proteasome activity is impaired, TRIM50 fails to drive its substrates to the proteasome-mediated degradation, and promotes their storage in the aggresome for successive clearance.
See all (11) citations in PubMed
See citations in PubMed for homologs of this gene provided by HomoloGene

TRIM50 K372 asetyloituu tai ubikitinoituu

HDAC6 on TRIM50:n deasetylaasi

  • HDAC6 on sikäli aintulaatuinen histonideasetylaasi, että sillä on kaksi deasetyloivaa domeenia ja ubikitiiniä sitova domeeni.Se tekee lukuisia proteiinien deaseylointeja sytoplasmassa. Jotkut porteiinit deasetyloituvat sen vaikutuksesta ( kuten TRIM50). Toiset voivat vaikuttaa HDAC6 funktioon moduloimalla sen katalyyttistä aktiivisuutta ( kuten p300, joka asetyloi sen ja samalla poistaa HDAC6:n deasetylaatiokyvyn) ja jotkut vaikuttava siihen ubikitiiniä sitovalla aktiviteetilla. HDAC&:lla on merkitystä aggresomi-autofagiatiessä, joka spesifisesti kohdistuu proteiiniaggrekaatteihin tai vaurioituneisiin organelleihin , kerää niitä kokoon ja siten hajoittaa ne. HDAC6:n kanssa interaktiossa oelvat partnerit (kuten TRIM50) ovat olennaisia komponentteja tässä autofagiatiessä. Aggresomi-autofagiatie on kiinnostava terapeuttinen kohde neurodegeneratiivisissa taudeissa ja antaa perspektiiviä siitä, miten HDAC6 on kohdennettavissa.
  • Cytoplasmic localization and possession of two deacetylase domains and a ubiquitin-binding domain make histone deacetylase 6 (HDAC6) a unique histone deacetylase. HDAC6 interacts with a number of proteins in the cytoplasm. Some of these proteins can be deacetylated by HDAC6 deacetylase activity. Others can affect HDAC6 functions by modulating its catalytic activity or ubiquitin-binding capability. Over the last decade, HDAC6 has been shown to play important roles in the aggresome-autophagy pathway, which selectively targets on protein aggregates or damaged organelles for their accumulation and clearance in cells. HDAC6-interacting partners are integral components in this pathway with regard to their regulatory roles through interaction with HDAC6. The aggresome-autophagy pathway appears to be an attractive therapeutic target for the treatment of neurodegenerative diseases as accumulation of protein aggregates are hallmarks in these diseases. In the current review, I discuss the molecular details of how HDAC6 and its interacting partners regulate each individual step in the aggresome-autophagy pathway and also provide perspectives of how HDAC6 can be targeted in treating neurodegenerative diseases.

PROTEOSOMITIE VAI AUTOFAGOSOMITIE?

Rakenne

cd00021
Location:90 → 125
BBOX; B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
cd13743
Location:282 → 468
SPRY_PRY_TRIM50; PRY/SPRY domain in tripartite motif-binding protein 50 (TRIM50)
cl17238
Location:16 → 56
RING; RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in ... 
  • CDS             
  •    /translation="MAWQVSLPELEDRLQCPICLEVFKEPLMLQCGHSYCKGCLVSLS
                     CHLDAELRCPVCRQAVDGSSSLPNVSLARVIEALRLPGDPEPKVCVHHRNPLSLFCEK
                     DQELICGLCGLLGSHQHHPVTPVSTVYSRMKEELAALISELKQEQKKVDELIAKLVNN
                     RTRIVNESDVFSWVIRREFQELHHLVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGT
                     RERLAQAECVLEQFGNEDHHKFIRFHSMASRAEMPQARPLEGAFSPISFKPGLHQADI
                     KLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYS
                     TCVLASRGFSCGRHYWEVVVGSKSDWRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGR
                     VYEAFACPRVPLPVAGHPHRIGLYLHYEQGELTFFDADRPDDLRPLYTFQADFQGKLY
                     PILDTCWHERGSNSLPMVLPPPSGPGPLSPEQPTKL"
    Muistiin 6.4. 2018
Upplagd av kl.
Etiketter: , , , ,

Inga kommentarer:

Skicka en kommentar

Prenumerera på: Kommentarer till inlägget (Atom)