TRIM 58, kr.1q44
Tämä geeni
indusoituu myöhäisvaiheessa erytropoieesia ja proteiini ubikitinoi
mikrotubulisen moottorin dyneiinin DYNC1LI1/DYNC1IL2 ja stimuloi
dyneiiniholoproteiinikompleksin degradaatiota. Saattaa osallistua
erytroblastin enukleaatioprosessiin säätelemällä nukleaarista
polarisaatiota.Epigeneettinen modifikaatio, metyloituminen, korreloi ikään ja TRIM58 kuuluu ikään korreloituviin geeneihin joita foidaan forenssisessa tieteessä hyödyntää iän arvioimisessa. Eräissä syövissä TRIM58 on metyloitunut ( keuhkosyövän alkuvaihe, maksasolusyöpä).
Lähde 1.
GeneCards Summary for TRIM58 Gene TRIM58 (Tripartite Motif Containing 58) is a Protein Coding gene. GO annotations related to this gene include ligase activity. An important paralog of this gene is TRIM11.UniProtKB/Swiss-Prot for TRIM58 Gene
-
E3 ubiquitin ligase induced during late erythropoiesis. Directly binds and ubiquitinates the intermediate chain of the microtubule motor dynein (DYNC1LI1/DYNC1LI2), stimulating the degradation of the dynein holoprotein complex. May participate in the erythroblast enucleation process through regulation of nuclear polarization.
Lähde 2. Aminohapporakenne 1-486.
http://www.uniprot.org/blast/?about=Q8NG06[1-486]&key=Chain&id=PRO_0000272301
Proteiini 1-486
peptidirakenne
>sp|Q8NG06|1-486
MAWAPPGERLREDARCPVCLDFLQEPVSVDCGHSFCLRCISEFCEKSDGAQGGVYACPQC
RGPFRPSGFRPNRQLAGLVESVRRLGLGAGPGARRCARHGEDLSRFCEEDEAALCWVCDA
GPEHRTHRTAPLQEAAGSYQVKLQMALELMRKELEDALTQEANVGKKTVIWKEKVEMQRQ
RFRLEFEKHRGFLAQEEQRQLRRLEAEERATLQRLRESKSRLVQQSKALKELADELQERC
QRPALGLLEGVRGVLSRSKAVTRLEAENIPMELKTACCIPGRRELLRKFQVDVKLDPATA
HPSLLLTADLRSVQDGEPWRDVPNNPERFDTWPCILGLQSFSSGRHYWEVLVGEGAEWGL
GVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAG
EISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASD
VRDDHL
Lähde 3. TRIM 58 on tärkeä tekijä kypsän punasolun muodostumisessa.
Dev
Cell. 2014 Sep 29;30(6):688-700. doi:
10.1016/j.devcel.2014.07.021. Epub 2014 Sep 18.
Trim58 degrades
Dynein and regulates terminal erythropoiesis.
Thom
CS1, Traxler
EA1, Khandros
E1, Nickas
JM2, Zhou
OY2, Lazarus
JE3, Silva
AP4, Prabhu
D2, Yao
Y2, Aribeana
C2, Fuchs
SY5, Mackay
JP4, Holzbaur
EL6, Weiss
MJ
TRIM58 is an E3
ubiquitin ligase superfamily member implicated by genome-wide
association studies to regulate human erythrocyte traits. Here, we
show that Trim58 expression is induced during late erythropoiesis and
that its depletion by small hairpin RNAs (shRNAs) inhibits the
maturation of late-stage nucleated erythroblasts to anucleate
reticulocytes. Imaging flow cytometry studies demonstrate that Trim58
regulates polarization and/or extrusion of erythroblast nuclei. In
vitro, Trim58 directly binds and ubiquitinates the intermediate chain
of the microtubule motor dynein. In cells, Trim58 stimulates
proteasome-dependent degradation of the dynein holoprotein complex.
During erythropoiesis, Trim58 expression, dynein loss, and
enucleation occur concomitantly, and all are inhibited by Trim58
shRNAs. Dynein regulates nuclear positioning and microtubule
organization, both of which undergo dramatic changes during
erythroblast enucleation. Thus, we propose that Trim58 promotes this
process by eliminating dynein. Our findings identify an
erythroid-specific regulator of enucleation and elucidate a
previously unrecognized mechanism for controlling dynein activity.
Lähde 4. TRIM 58 tuumorisuppressorigeenikandidaatti alkavassa keuhkosyövässä
Oncotarget.
2017 Jan 10;8(2):2890-2905. doi: 10.18632/oncotarget.13761.
Frequent silencing
of the candidate tumor suppressor TRIM58 by promoter methylation in
early-stage lung adenocarcinoma.
Kajiura
K1,2, Masuda
K1, Naruto
T1, Kohmoto
T1, Watabnabe
M1, Tsuboi
M2, Takizawa
H2, Kondo
K3, Tangoku
A2, Imoto
I1.
Lähde 5. TRIM58 maksasolusyövässä metyloitunut
Oncol
Rep. 2016 Aug;36(2):811-8. doi: 10.3892/or.2016.4871. Epub 2016
Jun 13.
Aberrant methylation
of TRIM58 in hepatocellular carcinoma and its potential clinical
implication.
Qiu
X1, Huang
Y1, Zhou
Y1, Zheng
F1.Abstract
TRIM58 (tripartite
motif containing 58) has been reported as a novel methylated gene in
hepatocellular carcinoma (HCC) by methylation microarrays. However,
its associations with mRNA expression and clinicopathological
characteristics have not been evaluated. In this study, we explored
the potential clinical implications of TRIM58 methylation in HCC.
We analyzed the methylation level of TRIM58 in 181 HCC tissues,
172 matched adjacent non-tumor tissues and 13 normal
liver tissues using methylation-sensitive restriction enzyme based
quantitative PCR and bisulfite genomic sequencing. Further, the mRNA
expression level of TRIM58 was measured in 46 paired HCC and
adjacent non-tumor tissues by quantitative real-time PCR. Moreover,
the relationship between TRIM58 methylation and mRNA expression, the
clinicopathological features, as well as prognostic value were
evaluated. The results showed that TRIM58 methylation was
significantly higher in HCC tissues compared with adjacent non-tumor
tissues and normal liver tissues (both p<0 .0001="" b="">Using 10% as
the cut-off value, hypermethylation of TRIM58 was specific in HCC
tissues (28.18%, 51/181), with a tendency to correlate with
unfavorable disease-free survival (p=0.047). Moreover, TRIM58
expression was significantly decreased in HCC tissues compared with
adjacent non-tumor tissues (p0><0 .0001="" b=""><0 .0001="" a="" after="" and="" application="" associated="" association="" be="" clinical="" common="" contribute="" data="" dfs="" dna="" downregulation="" event="" expression.="" further="" furthermore="" hcc="" hepatectomy.="" however="" hypermethylation="" in="" indicate="" investigated.="" is="" its="" may="" methylation="" mrna="" need="" negative="" of="" our="" p="" potential="" rs=" -0.260)." showed="" tends="" that="" the="" to="" trim58="" with="" worse="">
0>0>
Lähde. 6. Ihmisen ikä assosioituu epigeneettiseen modifikaatioon. Tämä näkyy mm TRIM58 geenissä.
Forensic
Sci Int. 2016 Jul;264:132-8. doi:
10.1016/j.forsciint.2016.03.047. Epub 2016 Apr 14.
The EpiTect Methyl
qPCR Assay as novel age estimation method in forensic biology.
Human aging is
associated with epigenetic modification of the genome. DNA
methylation at cytosines appears currently as the best characterised
modification that occurs during the mammalian lifetime. Such
methylation changes at regulatory region can provide insights to
track contributor age for criminal investigation. The EpiTect Methyl
II PCR system (QIAGEN) was used to compare methylation levels of CpG
islands in the promoter regions of a number of age related genes,
of which four successfully showed changes across the lifespan (NPTX2,
KCNQ1DN, GRIA2 and TRIM58). This technique is based on the
detection of remaining input genome after digestion with a
methylation-sensitive restriction enzyme. This study examined DNA
specimens from 80 female subjects of various ages (18-91 years)
obtained from blood, using primers designed to flank the studied gene
loci. The data obtained from DNA methylation quantification showed
successful discrimination among volunteered ages. Overall, the
difference between predicted and real age was about 11 years and
absolute mean differences (AMD) was only 7.2 years error. We suggest
the EpiTect system can be used as fast and simple innovative tool in
future forensic age estimation. KEYWORDS: Aging; CpG Island; DNA
methylation; Epigenetics; Gene promoter; Methylation-sensitive
restriction
Lisäartikkelita PubMed lähteessä:
Related articles in PubMed
-
Frequent silencing of the candidate tumor suppressor TRIM58 by promoter methylation in early-stage lung adenocarcinoma. Kajiura K, et al. Oncotarget, 2017 Jan 10. PMID 27926516, Free PMC Article
-
Trim58 degrades Dynein and regulates terminal erythropoiesis. Thom CS, et al. Dev Cell, 2014 Sep 29. PMID 25241935, Free PMC Article
-
Seventy-five genetic loci influencing the human red blood cell. van der Harst P, et al. Nature, 2012 Dec 20. PMID 23222517, Free PMC Article Anaemia is a chief determinant of global ill health, contributing to cognitive impairment, growth retardation and impaired physical capacity. To understand further the genetic factors influencing red blood cells, we carried out a genome-wide association study of haemoglobin concentration and related parameters in up to 135,367 individuals. Here we identify 75 independent genetic loci associated with one or more red blood cell phenotypes at P < 10(-8), which together explain 4-9% of the phenotypic variance per trait. Using expression quantitative trait loci and bioinformatic strategies, we identify 121 candidate genes enriched in functions relevant to red blood cell biology. The candidate genes are expressed preferentially in red blood cell precursors, and 43 have haematopoietic phenotypes in Mus musculus or Drosophila melanogaster. Through open-chromatin and coding-variant analyses we identify potential causal genetic variants at 41 loci. Our findings provide extensive new insights into genetic mechanisms and biological pathways controlling red blood cell formation and function.
-
New gene functions in megakaryopoiesis and platelet formation. Gieger C, et al. Nature, 2011 Nov 30. PMID 22139419, Free PMC Article
- Genome-wide association study of hematological and biochemical traits in a Japanese population. Kamatani Y, et al. Nat Genet, 2010 Mar. PMID 20139978
GeneRIFs: Gene References Into Functions
Muistiin geenistä
TRIM58 ( proteiini B1A2)joka sijaitse kromosomissa 1 kohdassa 1q44.
Sen tärkeä paralogi on TRIM11 (proteiini
B1A1). Sijaitsee kormosomissa 1, 1q42,13.
20.3. 2018
Kromosomi 1:n TRIM-proteiineja
Kromosomi 1:n TRIM-proteiineja
Inga kommentarer:
Skicka en kommentar